PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676725924
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family ZF-HD
Protein Properties Length: 88aa    MW: 9791.93 Da    PI: 8.1213
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676725924genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer107.29.9e-342279260
  ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                 ++vrY eC+kNhAa++Gg+avDGC+Efm+s g egt +al+CaACgCHRnFHRreve+e
    676725924 22 SNVRYVECQKNHAANIGGYAVDGCREFMAS-GVEGTDDALTCAACGCHRNFHRREVETE 79
                 689**************************9.999*********************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-32188IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.0E-302376IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015669.3E-282576IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.2922675IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048509Biological Processregulation of meristem development
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MKKRQVVIKQ RKNSYTTTSS SSNVRYVECQ KNHAANIGGY AVDGCREFMA SGVEGTDDAL  60
TCAACGCHRN FHRREVETEV VCEYSPPN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0118098e-81AC011809.2 Arabidopsis thaliana chromosome I BAC F6A14 genomic sequence, complete sequence.
GenBankCP0026848e-81CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankDQ2176088e-81DQ217608.1 Arabidopsis thaliana mini zinc finger 3 (MIF3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013728114.16e-55PREDICTED: mini zinc finger protein 3-like
RefseqXP_013728135.16e-55PREDICTED: mini zinc finger protein 3-like
SwissprotQ2Q4936e-49MIF3_ARATH; Mini zinc finger protein 3
TrEMBLA0A078D3U77e-55A0A078D3U7_BRANA; BnaC08g18380D protein
STRINGfgenesh2_kg.1__2061__AT1G18835.11e-52(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM94428114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18835.12e-48mini zinc finger